๐Ÿฑ Prepared Meals usda Verified

Labneh with zaatar, strained yogurt

Per 100g

Labneh with zaatar, strained yogurt nutrition facts - 100g serving
Nutrition facts 100g
121 Calories
Protein 5.8g
Carbs 3.9g
Fat 9.4g
Fiber 0.6g
Sugar 2.1g
Sodium 287mg
Calcium 108mg

About this food

A ready-in-minutes option for busy days, Labneh with zaatar is all about convenience with real flavor. It is something of a breakfast staple, making it easy to start the day well.

Tags: breakfastmiddle-easterndairysavory