๐Ÿฑ Prepared Meals usda Verified

Falafel plate, with hummus

Per 100g

Falafel plate, with hummus nutrition facts - 100g serving
Nutrition facts 100g
198 Calories
Protein 8.6g
Carbs 22.4g
Fat 9.8g
Fiber 4.8g
Sugar 1.8g
Sodium 468mg
Iron 2.2mg

About this food

A ready-in-minutes option for busy days, Falafel plate is all about convenience with real flavor. Protein is a real plus here, worth noting when you're putting together a filling plate. The fiber content is a real plus here, helping you feel fuller for longer. A meaningful dose of iron is worth noting, as it supports energy and blood health. Its sodium runs a little higher, which is worth keeping in mind on lower-salt days. The kind of food plant-based menus lean on, it keeps meals satisfying without a trace of fuss.

Tags: middle-easternfalafelveganchickpea